PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3DL_46F83C41D.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 106aa    MW: 12380.1 Da    PI: 9.9609
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3DL_46F83C41D.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.71.5e-094361648
                           HHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding 16 vkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           + ++G g+W++++r  g+ R++k+c++rw +yl
  Traes_3DL_46F83C41D.1  4 IIRYGVGCWSSVPRLAGLERCGKSCRLRWINYL 36
                           6689***************************97 PP

2Myb_DNA-binding538.1e-174285146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                           rg+++++E++l+v ++k lG++ W+ Ia+ ++ gRt++++k++w++
  Traes_3DL_46F83C41D.1 42 RGSFSQQEEDLIVSLHKILGNR-WSQIASQLP-GRTDNEIKNFWNS 85
                           89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM0071717138IPR001005SANT/Myb domain
PROSITE profilePS5129410.009136IPR017930Myb domain
CDDcd001672.49E-4136No hitNo description
Gene3DG3DSA:1.10.10.604.0E-15443IPR009057Homeodomain-like
PfamPF002493.4E-7536IPR001005SANT/Myb domain
SuperFamilySSF466892.02E-222297IPR009057Homeodomain-like
PROSITE profilePS5129424.9083791IPR017930Myb domain
SMARTSM007176.5E-154189IPR001005SANT/Myb domain
PfamPF002494.4E-154285IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-264491IPR009057Homeodomain-like
CDDcd001672.22E-104484No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
YNHIIRYGVG CWSSVPRLAG LERCGKSCRL RWINYLRPDL KRGSFSQQEE DLIVSLHKIL  60
GNRWSQIASQ LPGRTDNEIK NFWNSCIKKK LRQQSIDPTT HEPLND
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-2649122108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0925931e-120FP092593.1 Phyllostachys edulis cDNA clone: bphylf046j05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001170039.12e-71MYB transcription factor
SwissprotP200271e-65MYB3_HORVU; Myb-related protein Hv33
TrEMBLM7ZP312e-73M7ZP31_TRIUA; Myb-related protein Hv33
TrEMBLM8BJW81e-73M8BJW8_AEGTA; Myb-related protein Hv33
TrEMBLW5D9I91e-74W5D9I9_WHEAT; Uncharacterized protein
STRINGGRMZM2G064744_P017e-71(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111643041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.15e-61myb domain protein 86
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]